Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MILFTLRKKGGKRYMNYFISDMHFFHERLLGKNDFAPRLFANVDEMNQQLITSWNAVIKETDHVYHLGDLAMHPQYEKANAEILELVTQLQGTIHLIKGNHDSRAFFRYLEKNDPRLTDGSPKFYFYDVGAIVKFDHQQYYLTHYPMLLGPNDTIRNLHGHIHHYSVPIENDVNVGVDAPERELLKEKLPFGTPLSEQQIKEIYEAKRKYDRS 2DFJ Chain:B ((2-71)) --------------ATYLIGDVHGCYDE------------------LIALLHKVEFT-PGKDTLWLTGDLVARGPGS---LDVLRYVKSLGDSVRLVLGNHDLHLL-----------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2DFJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 264 -39996 -151.50 -571.36 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain B : 0.60 3D Compatibility (PKB) : -151.50 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.440

(partial model without unconserved sides chains): PDB file : Tito_2DFJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2DFJ-query.scw PDB file : Tito_Scwrl_2DFJ.pdb: