Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWYHGAIPRAEVAELLV---HSGDFLVRESQGKQ-EYVLSVLWDGLPRHF-IIQSLDNLYRLEGEGFPSIPLLIDHL
3OVE Chain:A ((8-82))WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDY-


General information:
TITO was launched using:
RESULT:

Template: 3OVE.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 227 5242 23.09 74.89
target 2D structure prediction score : 0.53
Monomeric hydrophicity matching model chain A : 0.73

3D Compatibility (PKB) : 23.09
2D Compatibility (Sec. Struct. Predict.) : 0.53
1D Compatibility (Hydrophobicity) : 0.73
QMean score : 0.525

(partial model without unconserved sides chains):
PDB file : Tito_3OVE.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3OVE-query.scw
PDB file : Tito_Scwrl_3OVE.pdb: