Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMYYTLEEKEVFMREALREAEIALEHDEIPIGCVIVKDGEIIGRGHNAREELQRAVMHAEIMAIEDANLSEESWRLLDCTLFVTIEPCVMCSGAIGLARIPNVVYGAKNQKFGAAGSLYDILTDERLNHRVEVETGILEDECAAIMQDFFRNRRKK
2B3J Chain:B ((4-154))----MTNDIYFMTLAIEEAKKAAQLGEVPIGAIITKDDEVIARAHNLRETLQQPTAHAEHIAIERAAKVLGSWRLEGCTLYVTLEPCVMCAGTIVMSRIPRVVYGADDPKGGCSGSLMNLLQQSNFNHRAIVDKGVLKEACSTLLTTFFKNLRAN


General information:
TITO was launched using:
RESULT:

Template: 2B3J.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 850 -106031 -124.74 -702.19
target 2D structure prediction score : 0.59
Monomeric hydrophicity matching model chain B : 0.83

3D Compatibility (PKB) : -124.74
2D Compatibility (Sec. Struct. Predict.) : 0.59
1D Compatibility (Hydrophobicity) : 0.83
QMean score : 0.578

(partial model without unconserved sides chains):
PDB file : Tito_2B3J.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2B3J-query.scw
PDB file : Tito_Scwrl_2B3J.pdb: