Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKEKEFRRNMAVFPIGSVMKLTDLSARQIRYYEDQELIKPD-RNEGNRRMYSLNDMDRLLEIKDYISEGYNIAAIKKKYAEREAKSKKAVSQTEVRRALHNELLQQGRFASVQSPFGRG 5GPE Chain:G ((1-74)) -----------MMRIGELGKKADCLVQTVRFYESEGLLPEPARSEGNFRLYDEVHLQRLLFIRRCRAKDMTLDEIRQLLNLRDRP----------------------------------

General information: TITO was launched using: RESULT: Template: 5GPE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 225 -16181 -71.92 -221.66 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain G : 0.69 3D Compatibility (PKB) : -71.92 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.782

(partial model without unconserved sides chains): PDB file : Tito_5GPE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5GPE-query.scw PDB file : Tito_Scwrl_5GPE.pdb: