Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNMKLLIENMTCGGCARGVTATIQDVDPNAKVDVDLASKIVTVESSESVDKITEALEEDGFPAKVQ 2XMJ Chain:B ((2-63)) -TIQLTVPTIACEACA-AVTKAVQNEDAQATVQVDLTSKKVTITSALGEEQLRTAIASAGHEV---

General information: TITO was launched using: RESULT: Template: 2XMJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 253 -39189 -154.90 -642.44 target 2D structure prediction score : 0.77 Monomeric hydrophicity matching model chain B : 0.78 3D Compatibility (PKB) : -154.90 2D Compatibility (Sec. Struct. Predict.) : 0.77 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.565

(partial model without unconserved sides chains): PDB file : Tito_2XMJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2XMJ-query.scw PDB file : Tito_Scwrl_2XMJ.pdb: