Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRH------RQVKHYRIFRLPNNWYYISPRLTFQCLEDLMNHY 1AOT Chain:F ((7-89)) WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHY

General information: TITO was launched using: RESULT: Template: 1AOT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 295 -4099 -13.89 -53.23 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain F : 0.84 3D Compatibility (PKB) : -13.89 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.498

(partial model without unconserved sides chains): PDB file : Tito_1AOT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1AOT-query.scw PDB file : Tito_Scwrl_1AOT.pdb: