Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHEGLSRHQAENLLMG-KEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYY 2AOB Chain:C ((6-81)) WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 2AOB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 215 -16664 -77.51 -222.19 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain C : 0.86 3D Compatibility (PKB) : -77.51 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.86 QMean score : 0.598

(partial model without unconserved sides chains): PDB file : Tito_2AOB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2AOB-query.scw PDB file : Tito_Scwrl_2AOB.pdb: