Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPFVRIDLFEGRTLEQKKALAKEVTEAVVRNTGAPQSAVHVIINDMPEGTYFPQGEMRTK 5CLO Chain:M ((1-57)) -PIAQIHILEGRSDEQKETLIREVSEAISRSLDAPLTSVRVIITEYAKGHAGIGGELA--

General information: TITO was launched using: RESULT: Template: 5CLO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain M - contact count / total energy / energy per contact / energy per residue : 140 -20340 -145.29 -356.84 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain M : 0.83 3D Compatibility (PKB) : -145.29 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.83 QMean score : 0.823

(partial model without unconserved sides chains): PDB file : Tito_5CLO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5CLO-query.scw PDB file : Tito_Scwrl_5CLO.pdb: