Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------------------------------MRDKIRLVSSAGT--GYFYTTTKNKRTMP-EKMEIKKFDPKIRQHVIFKEAKIK------------------- 1Y9L Chain:A ((6-115)) EKEWHIVPVSKDYFSIPNDLLWSFNTTNKSINVYSKCISGKAVYSFNAGKFMGNFNVKEVDGCFMDAQKIAIDKLFSMLKDGVVLKGNKINDTILIEKDGEVKLKLIRGI

General information: TITO was launched using: RESULT: Template: 1Y9L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 115 10148 88.24 198.98 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : 88.24 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.402

(partial model without unconserved sides chains): PDB file : Tito_1Y9L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1Y9L-query.scw PDB file : Tito_Scwrl_1Y9L.pdb: