Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPMVIRLKKQRYTCKNCRSHWNAQSYFIRPRHSISNHVRHKITSLLTEKVSLFFISKSC 1VD4 Chain:A ((10-27)) ------TNRASFKCPVCSSTFTDL-----------------------------------

General information: TITO was launched using: RESULT: Template: 1VD4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 20 -488 -24.38 -27.08 target 2D structure prediction score : 0.22 Monomeric hydrophicity matching model chain A : 0.50 3D Compatibility (PKB) : -24.38 2D Compatibility (Sec. Struct. Predict.) : 0.22 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.499

(partial model without unconserved sides chains): PDB file : Tito_1VD4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1VD4-query.scw PDB file : Tito_Scwrl_1VD4.pdb: