Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTAEGLYRITEKKAFRGLTELVEFY 2LNX Chain:A ((673-747)) WFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHIKVVEKDNWIHITEAKKFDSLLELVEYY

General information: TITO was launched using: RESULT: Template: 2LNX.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 258 -38497 -149.21 -513.29 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.88 3D Compatibility (PKB) : -149.21 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.88 QMean score : 0.471

(partial model without unconserved sides chains): PDB file : Tito_2LNX.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LNX-query.scw PDB file : Tito_Scwrl_2LNX.pdb: