Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WNHGNITRSKAEELLSRTGKDGSFLVRASESISRAYALCVLYRNCVYTYRILPNEDDKFTVQASEGVSMRFFTKLDQLIEFY 1M27 Chain:A ((8-84)) --HGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLI---

General information: TITO was launched using: RESULT: Template: 1M27.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 245 -46583 -190.13 -604.97 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.82 3D Compatibility (PKB) : -190.13 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.587

(partial model without unconserved sides chains): PDB file : Tito_1M27.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1M27-query.scw PDB file : Tito_Scwrl_1M27.pdb: