Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYSGNCDRYAVESALLHLQKDGAYTVRPSSGPHGSQPFTLAVLLRGRVFNIPIRRLDGGRHYALGREGRNREELFSSVAAMVQHF 5IBS Chain:A ((7-115)) WFHPNITGVEAENLLLTRGVDGSFLARP----PGD--FTLSVRRNGAVTHIKIQ--NTGDYYDL-----YGGEKFATLAQLVQYY

General information: TITO was launched using: RESULT: Template: 5IBS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 267 -46130 -172.77 -640.69 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.73 3D Compatibility (PKB) : -172.77 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.73 QMean score : 0.578

(partial model without unconserved sides chains): PDB file : Tito_5IBS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5IBS-query.scw PDB file : Tito_Scwrl_5IBS.pdb: