Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFKPNITREQAIELLRKEEPGAFVIRDSSSYRGSFGLALKVQEVPASAQSRPGEDSNDLIRHFLIESSAKGVHLKGADEEPYFGSLSAFVCQH 1K9A Chain:A ((82-159)) WFHGKITREQAERLLYPPETGLFLVRESTNYPGDYTLCVSCE---------------GKVEHYRIMYHASKLSI---DEEVYFENLMQLV---

General information: TITO was launched using: RESULT: Template: 1K9A.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 261 -46083 -176.56 -640.04 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain A : 0.77 3D Compatibility (PKB) : -176.56 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.476

(partial model without unconserved sides chains): PDB file : Tito_1K9A.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1K9A-query.scw PDB file : Tito_Scwrl_1K9A.pdb: