Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIMLQKIYEQMANFYDSIEEEYGPTFGDNFDWEHVHFKFLIYYLVRYGIGCRKDFIVYHYRVAYRLYLEKLVMNRGFISC 4UFJ Chain:A ((127-157)) -------------------------LGKGFSWPYVNLQLTAYYVVRWILGAK----------------------------

General information: TITO was launched using: RESULT: Template: 4UFJ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 31 -3195 -103.05 -118.31 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 0.57 3D Compatibility (PKB) : -103.05 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.57 QMean score : 0.162

(partial model without unconserved sides chains): PDB file : Tito_4UFJ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4UFJ-query.scw PDB file : Tito_Scwrl_4UFJ.pdb: