Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIQIIVNTFIEKDKTGAVVEVLYASADQDKVQAKYEELAAQYPENYLAIYDVPLDTDLNTLDHYPSVFIEKEEFE 1RBL Chain:K ((62-89)) ----------------------FACAAPQQVLDEVRECRSEYGDCYIRVA-------------------------

General information: TITO was launched using: RESULT: Template: 1RBL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain K - contact count / total energy / energy per contact / energy per residue : 22 -5253 -238.75 -187.59 target 2D structure prediction score : 0.82 Monomeric hydrophicity matching model chain K : 0.61 3D Compatibility (PKB) : -238.75 2D Compatibility (Sec. Struct. Predict.) : 0.82 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.865

(partial model without unconserved sides chains): PDB file : Tito_1RBL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1RBL-query.scw PDB file : Tito_Scwrl_1RBL.pdb: