Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTNFDILDNQFLSLSENELSDIDGGLAPLVIFGVAVSWKAIAGGTALIGSGLAAGYFLGGD 1OCZ Chain:L ((1-39)) -------------------SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFI---

General information: TITO was launched using: RESULT: Template: 1OCZ.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 33 -3754 -113.76 -96.26 target 2D structure prediction score : 0.18 Monomeric hydrophicity matching model chain L : 0.71 3D Compatibility (PKB) : -113.76 2D Compatibility (Sec. Struct. Predict.) : 0.18 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.043

(partial model without unconserved sides chains): PDB file : Tito_1OCZ.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OCZ-query.scw PDB file : Tito_Scwrl_1OCZ.pdb: