Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTWFEEIFEEYKFEKGEGQCPRLLCFLVASFVKRVIIDCRIKGGIYERDSRIIY 4FIO Chain:C ((302-331)) ---FFDVFKDAGFDF-YQIDKGM--FAPAEVVINDL------------------

General information: TITO was launched using: RESULT: Template: 4FIO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 24 -5407 -225.27 -180.22 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain C : 0.56 3D Compatibility (PKB) : -225.27 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.564

(partial model without unconserved sides chains): PDB file : Tito_4FIO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4FIO-query.scw PDB file : Tito_Scwrl_4FIO.pdb: