Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLNSIVTIICIALIAFILFWFFKKPEKSGQKAQQKNGYQEIRVEVMGGYTPELIVLKKSVPARIVFDRKDPSPCLDQIVFPDFGVHANLPMGEEYVVEITPEQAGEFSFACGMNMMHGKMIVE 1IC0 Chain:A ((37-102)) --------------------------------------------------PETLVVKKGDAVKVVVENK--SPISEGFSIDAFGVQEVIKAGETKTISFTADKAGAFTIWC---QLHPKNI--

General information: TITO was launched using: RESULT: Template: 1IC0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 215 -30555 -142.12 -462.95 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.64 3D Compatibility (PKB) : -142.12 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.416

(partial model without unconserved sides chains): PDB file : Tito_1IC0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1IC0-query.scw PDB file : Tito_Scwrl_1IC0.pdb: