Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGVVGKQSSSFSLLFWLFSLSSGKVTCFKSGSLGNSSNILPKLSHFVNFTAIGVPRF 1ZR0 Chain:B ((22-49)) ------------LLRYYYDRYTQSCRQFLYGGCEGNANNF-----------------

General information: TITO was launched using: RESULT: Template: 1ZR0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 58 -10721 -184.84 -382.88 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain B : 0.53 3D Compatibility (PKB) : -184.84 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 1.022

(partial model without unconserved sides chains): PDB file : Tito_1ZR0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1ZR0-query.scw PDB file : Tito_Scwrl_1ZR0.pdb: