Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMQIYLNGELTDTP---SQNLLQLIQELALE-GKRFAVEHNQQIVPKSKLEQISIAQHDRIEIIHAVGGG
3CWI Chain:A ((1-69))MNLTVNGKPSTVDGAESLNVTELLSALKVAQAEYVTVELNGEVLEREAFDATTVKDGDAVEFLYFMGGG


General information:
TITO was launched using:
RESULT:

Template: 3CWI.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 228 9947 43.63 155.41
target 2D structure prediction score : 0.56
Monomeric hydrophicity matching model chain A : 0.78

3D Compatibility (PKB) : 43.63
2D Compatibility (Sec. Struct. Predict.) : 0.56
1D Compatibility (Hydrophobicity) : 0.78
QMean score : 0.288

(partial model without unconserved sides chains):
PDB file : Tito_3CWI.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3CWI-query.scw
PDB file : Tito_Scwrl_3CWI.pdb: