Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLIHYPVYFFFELIQASCNEYIASGSNKEDIMLLNRKHSLVSCFDLELLETHPVKIKNSKVKQKNFITVSLEFSFKKIPPIF 5EC3 Chain:A ((346-366)) --------LFLEVIQRH--NH--QGFGAGNFNS-------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5EC3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 9 -153 -16.94 -7.26 target 2D structure prediction score : 0.29 Monomeric hydrophicity matching model chain A : 0.52 3D Compatibility (PKB) : -16.94 2D Compatibility (Sec. Struct. Predict.) : 0.29 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.381

(partial model without unconserved sides chains): PDB file : Tito_5EC3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5EC3-query.scw PDB file : Tito_Scwrl_5EC3.pdb: