Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLILTRRVGETLMIGDQVSVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQHERAMHEHLQHLDQDYQVSYEDDNYAQKNFNR 2MFE Chain:A ((1-52)) MLILTRKVGESINIGDDITITILGVSGQQVRIGINAPKDVAVHREEIYQRIQ--------------------------------

General information: TITO was launched using: RESULT: Template: 2MFE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 106 -16619 -156.78 -319.60 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain A : 0.87 3D Compatibility (PKB) : -156.78 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.87 QMean score : 0.521

(partial model without unconserved sides chains): PDB file : Tito_2MFE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MFE-query.scw PDB file : Tito_Scwrl_2MFE.pdb: