Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSLQRG-IYQHYKGNLYQVFSVAKHSETEEELVVYQCLYGDYSTWVRPLDMFTETVQMSDGSIVPRFKLIQST 3CCY Chain:A ((43-55)) --CSKSRLYHYFDSK----------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3CCY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 5 -970 -194.00 -80.83 target 2D structure prediction score : 0.25 Monomeric hydrophicity matching model chain A : 0.51 3D Compatibility (PKB) : -194.00 2D Compatibility (Sec. Struct. Predict.) : 0.25 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.507

(partial model without unconserved sides chains): PDB file : Tito_3CCY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3CCY-query.scw PDB file : Tito_Scwrl_3CCY.pdb: