Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MELTLGLVAIASAILIAFGALGTAIGFGLLGGRFLEAVARQPELAPQLQTRMFLIAGLLDAVPMIGVGIGLFFIFANPFVG 1A91 Chain:A ((3-77)) -NLNMDLLYMAAAVMMGLAAIGAAIGIGILGGKFLEGAARQPDLIPLLRTQFFIVMGLVDAIPMIAVGLGLYVMFA-----

General information: TITO was launched using: RESULT: Template: 1A91.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 185 -37980 -205.29 -506.39 target 2D structure prediction score : 0.81 Monomeric hydrophicity matching model chain A : 0.90 3D Compatibility (PKB) : -205.29 2D Compatibility (Sec. Struct. Predict.) : 0.81 1D Compatibility (Hydrophobicity) : 0.90 QMean score : 0.388

(partial model without unconserved sides chains): PDB file : Tito_1A91.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1A91-query.scw PDB file : Tito_Scwrl_1A91.pdb: