Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)


Input alignment information:
Query sequenceMSGLLFVVSAASGTGKTSLVKALLDR--VSNLHVSVSHTTRGQRPGELDGVHYHFTTKDEFLDQVNQGGFIEYAEVFGNYYGTSQATVKQQLAQGHDVLLEIDWQGAEQVRKLFPESKQIFILPPTQFDLRQRLSNRGTDSVEVIEHRLSCAVEDMQHYVNFDYIIINDDFNKALHELEAVITANRLVLSQQAKRHQNLIQDLITPQPKQE
1S96 Chain:A ((16-218))--GTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRQPRPGEVHGEHYFFVNHDEFKEMISRDAFLEHAEVFGNYYGTSREAIEQVLATGVDVFLDIDWQGAQQIRQKMPHARSIFILPPSKIELDRRLRGRGQDSEEVIAKRMAQAVAEMSHYAEYDYLIVNDDFDTALTDLKTIIRAERLRMSRQKQRHDALISKLLA------


General information:
TITO was launched using:
RESULT:

Template: 1S96.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output 		Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 845 11851 14.02 58.96
target 2D structure prediction score : 0.79
Monomeric hydrophicity matching model chain A : 0.87

3D Compatibility (PKB) : 14.02
2D Compatibility (Sec. Struct. Predict.) : 0.79
1D Compatibility (Hydrophobicity) : 0.87
QMean score : 0.533

(partial model without unconserved sides chains):
PDB file : Tito_1S96.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1S96-query.scw
PDB file : Tito_Scwrl_1S96.pdb: