Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSFWQKLFLADQQHNEHKNQTACVENDCSCKTNEQLLSALAQATDEDVIKGIKKVLISRGYSRKELNELTQKTSIH 1VH4 Chain:A ((339-389)) ----------KLAEVDTKPQLEIYADDVKCSHGA-----TVGRIDDEQI----FYLRSRGINQQDAQQMI------

General information: TITO was launched using: RESULT: Template: 1VH4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 60 -9274 -154.57 -181.84 target 2D structure prediction score : 0.51 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -154.57 2D Compatibility (Sec. Struct. Predict.) : 0.51 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.596

(partial model without unconserved sides chains): PDB file : Tito_1VH4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1VH4-query.scw PDB file : Tito_Scwrl_1VH4.pdb: