Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MARNADYIDIA--GFTIAPQTLLPYGHLYNASLAGNQLNSAHGFAGPILAAPIWLINKPERFFAIAPYLYVPIGTYHSDEALNIDENRWKFDLQLGVFNNVAMIFLPKSRPMLFDMVHMMILLE 3VMV Chain:A ((158-200)) MKRNAEYITVSWNKFENHWKTML-VGHTDNASLAPDKITYHHNY--------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3VMV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 93 -2487 -26.74 -60.65 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.54 3D Compatibility (PKB) : -26.74 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.087

(partial model without unconserved sides chains): PDB file : Tito_3VMV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3VMV-query.scw PDB file : Tito_Scwrl_3VMV.pdb: