Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSKTLHSEKFAINFFIVDQVPQFARRIMTQVPQIGSRCVFKEKRFDIVGVEWCLDEDATNYEYQARINIELKPV 1YPC Chain:I ((66-83)) -----------VRLFVDKL------DNIAQVPRVG---------------------------------------

General information: TITO was launched using: RESULT: Template: 1YPC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 24 -4258 -177.42 -236.56 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain I : 0.61 3D Compatibility (PKB) : -177.42 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.454

(partial model without unconserved sides chains): PDB file : Tito_1YPC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1YPC-query.scw PDB file : Tito_Scwrl_1YPC.pdb: