Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDLQGCLIVIKTDVIFDESNIIIGLFTIKDDHGIIQISTNGNQVNWD---EWVDEAGGHSLEKAIIYCLNRKPPEDATHYKETKKQNSYRYYKKVEEDW---FIYVDWRYPLGWQPTGMFDDITKIKPLPQFG 5FFT Chain:A ((40-102)) -------------------------------------STNGQSVNFDTIKEMCTRAGGN-------IAVPRTPEENEAIASIAKKYNNYVYLG-IEDQTPGDFHYLD--------------------------

General information: TITO was launched using: RESULT: Template: 5FFT.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 112 8369 74.72 149.44 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : 74.72 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.271

(partial model without unconserved sides chains): PDB file : Tito_5FFT.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5FFT-query.scw PDB file : Tito_Scwrl_5FFT.pdb: