Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMPVMANYST-NDFKPGLKVMLDSNPCSIMENEYVKPGKGQAFNRVKLRNLKTGKVLEKTFKSGDTLEAADIVEVEMNYLYNDGEMWHFMDPESFEQIAADKTAMGDAAKWLKDDSNETCTIMLFNGVPLNVNAPNFVVLKVVETDPGVRGDTSGGGGKPAKLETGAVVRVPLFVQQEESVRVDTRTGEYLERA
3OYY Chain:A ((1-188))---MASMKTAQEFRAGQVANINGAPWVIQKAEFNKSGRNAAVVKMKLKNLLTGAGTETVFKADDKLEPIILDRKEVTYSYFADPLYVFMDSE-FNQYEIEKDDLEGVLTFIEDGMTDICEAVFYNDKVISVELPTTIVRQIAYTEPAVRGDTS--VMKTARLNNGAELQVSAFCEIGDSIEIDTRTGEYKSR-


General information:
TITO was launched using:
RESULT:

Template: 3OYY.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 772 47872 62.01 258.76
target 2D structure prediction score : 0.57
Monomeric hydrophicity matching model chain A : 0.75

3D Compatibility (PKB) : 62.01
2D Compatibility (Sec. Struct. Predict.) : 0.57
1D Compatibility (Hydrophobicity) : 0.75
QMean score : 0.476

(partial model without unconserved sides chains):
PDB file : Tito_3OYY.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3OYY-query.scw
PDB file : Tito_Scwrl_3OYY.pdb: