Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLRILKSILFEFEELMSQQSVEKKSVPWLLMGLGLLIPFLIIGILFLAAKSDAQNKKQYEQQRLEMEKRIAEKEAANSDKK 2QZV Chain:A ((672-705)) -----------------------------------------------AAKHEAQRLEQEARGRLERQKILDQSEAEKARKE

General information: TITO was launched using: RESULT: Template: 2QZV.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 19 2266 119.24 66.63 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.51 3D Compatibility (PKB) : 119.24 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.51 QMean score : 0.653

(partial model without unconserved sides chains): PDB file : Tito_2QZV.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2QZV-query.scw PDB file : Tito_Scwrl_2QZV.pdb: