Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MGANSTLIFGILINIAILLVFFRFLMQLAAVSPYNPVVLSTVKATKIVDIFGRIFPTVAKGRFNLAALVLLIILYLLKIFGVMYLSGSMPNSPVHLVILTFVTMIQDLIRFCRYLIFATIILSWVVMFTQSRSPYIEVIQDLAEPLLAPFRHLLPNMGMIDLSPILAFLALYIAEILMNEVAKVLLTGL 1OFD Chain:B ((492-530)) -----------------------------------------------------------------------------------------------------------------------------------YDYFKQRFAQVTNPPIDPLRENL-----------------------------------

General information: TITO was launched using: RESULT: Template: 1OFD.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 9 -13 -1.44 -0.57 target 2D structure prediction score : 0.17 Monomeric hydrophicity matching model chain B : 0.35 3D Compatibility (PKB) : -1.44 2D Compatibility (Sec. Struct. Predict.) : 0.17 1D Compatibility (Hydrophobicity) : 0.35 QMean score : 0.231

(partial model without unconserved sides chains): PDB file : Tito_1OFD.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1OFD-query.scw PDB file : Tito_Scwrl_1OFD.pdb: