Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEVKKLTREEVFNKVAKIISNHFEIDTDKVTDELNIKDDLKADSISIMEFVLELEDEFGTEISDEDAEQIETVGGAVDYISSHLK 1F80 Chain:D ((5-78)) -------SADTLERVTKIIVDRLGVDEADVKLEASFKEDLGAD-LDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQ----

General information: TITO was launched using: RESULT: Template: 1F80.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 259 -46083 -177.93 -631.27 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain D : 0.82 3D Compatibility (PKB) : -177.93 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.678

(partial model without unconserved sides chains): PDB file : Tito_1F80.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1F80-query.scw PDB file : Tito_Scwrl_1F80.pdb: