Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MIFFISEYINQTPFYSKNTEKINGGQVSTDFSIIVYFSGAFTDDKNFIMNLKNDTTKIKK 3KEW Chain:B ((33-50)) -------LLDQTAFFPGG-----GGQMG--------------------------------

General information: TITO was launched using: RESULT: Template: 3KEW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 8 -892 -111.50 -55.75 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain B : 0.60 3D Compatibility (PKB) : -111.50 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.459

(partial model without unconserved sides chains): PDB file : Tito_3KEW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3KEW-query.scw PDB file : Tito_Scwrl_3KEW.pdb: