Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLFVGIDVSSEKLDVCFLTDDNQLSILSEISVANDIEGASFIRETILEFNNSYHFDQNCDWHGVNVHVQLPSFHVFS 3H6E Chain:B ((3-31)) TGATIVIDLGKTLSKVSLWDLDGRM-----------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3H6E.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 47 -7632 -162.38 -305.28 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain B : 0.56 3D Compatibility (PKB) : -162.38 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.774

(partial model without unconserved sides chains): PDB file : Tito_3H6E.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3H6E-query.scw PDB file : Tito_Scwrl_3H6E.pdb: