Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMVAQIRIGQGMDVHAFEEGKFVTLAGVQIPHTHGLKAHSDGDVVLHALCDALLGALALGDIGQHFPDTDPEFKGADSRVLLKHVYQLILDRGYHLNNADITVACERPKLAKYNLEMRQSIADVLNVDLNQISIKATTTEKLGFTGRQEGILATATVLISH
2AMT Chain:E ((1-154))----MRIGHGFDVHAFGGEGPIIIGGVRIPYEKGLLAHSDGDVALHALTDALLGAAALGDIGKLFPDTDPAFKGADSRELLREAWRRIQAKGYTLGNVDVTIIAQAPKMLPHIPQMRVFIAEDLGCHMDDVNVKATTTEKLGFTGRGEGIACEAVALL--


General information:
TITO was launched using:
RESULT:

Template: 2AMT.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 860 -120994 -140.69 -785.67
target 2D structure prediction score : 0.72
Monomeric hydrophicity matching model chain E : 0.83

3D Compatibility (PKB) : -140.69
2D Compatibility (Sec. Struct. Predict.) : 0.72
1D Compatibility (Hydrophobicity) : 0.83
QMean score : 0.587

(partial model without unconserved sides chains):
PDB file : Tito_2AMT.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2AMT-query.scw
PDB file : Tito_Scwrl_2AMT.pdb: