Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMELNRMIDHTILKADASKEAVMQIIEEAKKY--HFYSVCINPAWVALAKEQLQ---GEPVAVCTVIGFPLGANTPETKAFETTDAINNGADEVDMVINIGALKSKDDQQVQKDIEAVVEAAK-DRALVKVIIETSLLDRE-EIIRACEIAKAAGADFVKTSTGFSTGGAKVEDVRLMRETV---GPEMGVKASGGIHNEEEAMAMIEAG------------ATRIGTSAGVAIVSGSTGEGY
5C5Y Chain:D ((10-243))-RALSLMDLTSLTNTETDQEIIDLCRQAKSPAGETAAICIFPRFIPVAKKALKAQQTPHIKIATVTNFPQGNDDLDIALAETRAAVAYGADEVDLVFPYRALIQGNET-IGFDMVKVCKQACSGNAKLKVIIETGELKSEELIRKASEIAINAGADFIKTSTGKVAINATPEAAKVMLTVIKNKNTAVGFKPAGGVRNADDAAIYLDLADNILGNEWADANHFRFGASSLLISLLD------


General information:
TITO was launched using:
RESULT:

Template: 5C5Y.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain D - contact count / total energy / energy per contact / energy per residue : 1172 1276 1.09 6.02
target 2D structure prediction score : 0.66
Monomeric hydrophicity matching model chain D : 0.76

3D Compatibility (PKB) : 1.09
2D Compatibility (Sec. Struct. Predict.) : 0.66
1D Compatibility (Hydrophobicity) : 0.76
QMean score : 0.540

(partial model without unconserved sides chains):
PDB file : Tito_5C5Y.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5C5Y-query.scw
PDB file : Tito_Scwrl_5C5Y.pdb: