Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -----------------------------------------------------------------DCTI-----------ERRLGTQT---KARARTSAKAMPEMIPAEPGKYTVIAGTRVWVYGDCRTYP-THLPDGSTISGRPFQASDVEEDC----------------------------------------------------- 1KK6 Chain:A ((1-207)) MGPNPMKMYPIEGNKSVQFIKPILEKLENVEVGEYSYYDSKNGETFDKQILYHYPILNDKLKIGKFCSIGPGVTIIMNGANHRMDGSTYPFNLFGNGWEKHMPKLDQLPIKGDTII-GNDVWIGKDVVIMPGVKIGDGAIVAANSVVVKDIAPYMLAGGNPANEIKQRFDQDTINQLLDIKWWNWPIDIINENIDKILDNSIIREVIW

General information: TITO was launched using: RESULT: Template: 1KK6.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 264 19593 74.22 264.77 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.58 3D Compatibility (PKB) : 74.22 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.261

(partial model without unconserved sides chains): PDB file : Tito_1KK6.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1KK6-query.scw PDB file : Tito_Scwrl_1KK6.pdb: