Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence METGTVKWFNSEKGFGFITAENGNDVFVHFSAIQGDGFKTLEEGQAVTFDVEEGQ--RGPQATNVTKA 3A0J Chain:B ((1-68)) MQKGRVKWFNAEKGYGFIEREGDTDVFVHYTAINAKGFRTLNEGDIVTFDVEPGRNGKGPQAVNVTVV

General information: TITO was launched using: RESULT: Template: 3A0J.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 282 -27401 -97.17 -415.17 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain B : 0.90 3D Compatibility (PKB) : -97.17 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.90 QMean score : 0.561

(partial model without unconserved sides chains): PDB file : Tito_3A0J.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3A0J-query.scw PDB file : Tito_Scwrl_3A0J.pdb: