Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWFFRSQGRKEAERQLLAPINKAGSFLIRESETNKGAFSLSVKDV-TTQGELIKHYKIRCLDEGGYYISPRITFPSLQALVQHY
4U17 Chain:C ((6-88))WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHY


General information:
TITO was launched using:
RESULT:

Template: 4U17.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 241 1113 4.62 13.57
target 2D structure prediction score : 0.72
Monomeric hydrophicity matching model chain C : 0.89

3D Compatibility (PKB) : 4.62
2D Compatibility (Sec. Struct. Predict.) : 0.72
1D Compatibility (Hydrophobicity) : 0.89
QMean score : 0.473

(partial model without unconserved sides chains):
PDB file : Tito_4U17.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-4U17-query.scw
PDB file : Tito_Scwrl_4U17.pdb: