Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence CFY-TVSRKEATEMLQKNPSLGNMILRPG-SDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELE----KPVTLPNLFSVIDYF 2MK2 Chain:A ((13-94)) WYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGAFALCVLYQK---HVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLY

General information: TITO was launched using: RESULT: Template: 2MK2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 257 -4444 -17.29 -58.47 target 2D structure prediction score : 0.74 Monomeric hydrophicity matching model chain A : 0.70 3D Compatibility (PKB) : -17.29 2D Compatibility (Sec. Struct. Predict.) : 0.74 1D Compatibility (Hydrophobicity) : 0.70 QMean score : 0.545

(partial model without unconserved sides chains): PDB file : Tito_2MK2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2MK2-query.scw PDB file : Tito_Scwrl_2MK2.pdb: