Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEVKKLTREEVFNKVAKIISNHFEIDTDKVTDELNIKDDLKADSISIMEFVLELEDEFGTEISDEDAEQIETVGGAVDYISSHLK 3GZM Chain:B ((7-80)) -----------FDDIKKIISKQLSVEEDKIQMNSNFTKDLGADSLDLVELIMALEEKFNVTISDQDALKINTVQDAIDYIEKNNK

General information: TITO was launched using: RESULT: Template: 3GZM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 253 -39882 -157.64 -538.95 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain B : 0.82 3D Compatibility (PKB) : -157.64 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.82 QMean score : 0.771

(partial model without unconserved sides chains): PDB file : Tito_3GZM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3GZM-query.scw PDB file : Tito_Scwrl_3GZM.pdb: