Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYFSGVSRTQAQQLLLSPPNEPGAFLIRPSESSLGGYSLSVRAQAKVCHYRVSMAADGSLYLQKGRLFPGLEELLTYY 3T04 Chain:A ((18-93)) WYHGPVSRNAAEYLLSSGIN--GSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHH

General information: TITO was launched using: RESULT: Template: 3T04.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 276 -46872 -169.82 -616.73 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain A : 0.79 3D Compatibility (PKB) : -169.82 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.79 QMean score : 0.616

(partial model without unconserved sides chains): PDB file : Tito_3T04.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3T04-query.scw PDB file : Tito_Scwrl_3T04.pdb: