Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MILEIMMKVKNIQSETAMKQHSESVVSNQFEPTCHSEHSSVSDVCSSSAFGLATRSSRARMKRASGFTLIEVMVVIVILGVLAALIVPNVMGRSEKAKIDTTQITLKGVAGALDQYKLDNGHFPTMQEGGLDALINQPATAKNWMPGGYVKGGYPKDSWKNDIQYVVPGKDDHPFDLYSFGADGKEGGEGNDADIYYQP 2HIL Chain:H ((1-58)) ------------------------------------------------------------------FTLIELMIVIAIVGILAAVALPAYQDYTARAQVSEAILLAEGQKSAVTEYYLNHGKWP---------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2HIL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 22 -2114 -96.07 -36.44 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain H : 0.62 3D Compatibility (PKB) : -96.07 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.304

(partial model without unconserved sides chains): PDB file : Tito_2HIL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2HIL-query.scw PDB file : Tito_Scwrl_2HIL.pdb: