Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYSKHMTRSQAEQLLKQEGKEGGFIVRDS-SKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQ-SQYYLAEKHLFSTIPELINYH 3TL0 Chain:A ((9-84)) WFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRR------NGAVTHIKIQNTGDYYDLYGGEK--FATLAELVQYY

General information: TITO was launched using: RESULT: Template: 3TL0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 272 -9329 -34.30 -126.06 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.81 3D Compatibility (PKB) : -34.30 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.81 QMean score : 0.779

(partial model without unconserved sides chains): PDB file : Tito_3TL0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3TL0-query.scw PDB file : Tito_Scwrl_3TL0.pdb: