Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MEVKKLTREEVFNKVAKIISNHFEIDTDKVTDELNIKDDLKADSISIMEFVLELEDEFGTEISDEDAEQIETVGGAVDYISSHLK 4ZJB Chain:G ((11-80)) ----------LFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAEKIVNVGDVVKYI-----

General information: TITO was launched using: RESULT: Template: 4ZJB.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 236 -56225 -238.24 -803.21 target 2D structure prediction score : 0.80 Monomeric hydrophicity matching model chain G : 0.84 3D Compatibility (PKB) : -238.24 2D Compatibility (Sec. Struct. Predict.) : 0.80 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.765

(partial model without unconserved sides chains): PDB file : Tito_4ZJB.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4ZJB-query.scw PDB file : Tito_Scwrl_4ZJB.pdb: