Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLD-----GAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY 1A1A Chain:B ((9-91)) WYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYSLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYY

General information: TITO was launched using: RESULT: Template: 1A1A.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 272 -2823 -10.38 -36.19 target 2D structure prediction score : 0.60 Monomeric hydrophicity matching model chain B : 0.85 3D Compatibility (PKB) : -10.38 2D Compatibility (Sec. Struct. Predict.) : 0.60 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.701

(partial model without unconserved sides chains): PDB file : Tito_1A1A.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1A1A-query.scw PDB file : Tito_Scwrl_1A1A.pdb: