Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRKRDRHQLIKKMITEEKLSTQKEIQDRLEAHNVCVTQTTLSRDLREIGLTKVKKNDMVYYVLVNETEKIDLVEFLSHHLEGVARAEFTLVLHTKLGEASVLANIVDVNKDEWILGTVAGANTLLVICRDQHVAKLMEDRLLDLMKDK 5JVO Chain:A ((3-79)) --------------------------------------------------------------------REKLRKMLDDLLVSVDHSGNIAVLRTPPGGAPFLASFIDRVGMEEVVGTIAGDDTVFVLARDPMTGQELGEFLSQRR---

General information: TITO was launched using: RESULT: Template: 5JVO.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 327 -59465 -181.85 -772.27 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain A : 0.67 3D Compatibility (PKB) : -181.85 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.521

(partial model without unconserved sides chains): PDB file : Tito_5JVO.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5JVO-query.scw PDB file : Tito_Scwrl_5JVO.pdb: