Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKITTAIVLSMSGLIATTAMAAPHDHYHHQGYETKTVKVIHKDDHANIWRAGQVVPHQYQHPRYVIDYRSHQKLTKPGRYQKWYKVNGNYVLVNEREFGLSRI 1PFS Chain:A ((1-78)) ---MNIQITFTDSVRQGTSA--KGNPYTFQEGFL-------HLEDKPHPLQCQFFVESVIPAGSYQVPYRINVNNGRPELAFDFKAMKRA--------------

General information: TITO was launched using: RESULT: Template: 1PFS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 259 -24238 -93.58 -310.74 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain A : 0.61 3D Compatibility (PKB) : -93.58 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.092

(partial model without unconserved sides chains): PDB file : Tito_1PFS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1PFS-query.scw PDB file : Tito_Scwrl_1PFS.pdb: